PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009803486.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GRAS
Protein Properties Length: 626aa    MW: 69164 Da    PI: 5.8685
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009803486.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS2739.2e-842656253374
            GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshlt 97 
                     ++++++ e + +g++++aq +Larl+++ sp g+p++R a+yf+eAL    +   + ++ ++pp+  ++ + + ++ a+k+fse+sP+++f ++t
  XP_009803486.1 265 DQIFQASELLLAGQFSNAQMILARLNQQLSPLGKPFKRSAFYFKEALLLPFLL--PCTSTSFPPRIPTPFDCVLKMDAYKAFSEISPLIQFMNFT 357
                     67899999999************************************998887..7777889***99999************************* PP

            GRAS  98 aNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrle..dle 190
                      Nq Ilea+  ++++HiiDfdi+ G+QW +++q+L s ++++ sl+iT+++sp+++++ e+  ++e L+ fA+ +g++fe +v+  ++++  +  
  XP_009803486.1 358 SNQPILEALGDAKEIHIIDFDIGCGAQWSSFMQELRSSNRKATSLKITAFVSPSTHHSVEIGIMHESLTLFANDVGIRFELEVINLDSFDpkTYP 452
                     ***********************************************************************************977765411567 PP

            GRAS 191 leeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikv 285
                     l++Lr ++ Ea+a+n+ +   +      +     +++L+++k+lsPkvvv  e+ +++++ ++ +++l+al+yy  l+ s++a    + e  +k+
  XP_009803486.1 453 LSSLRSSECEAIAINFPIWSISSC--LFA----FPSLLHCMKQLSPKVVVSLERGCERTELPLKHHLLHALQYYEILLASIDAA-NLTPEIGKKI 540
                     8999************99555444..344....456*********************************************555.34778999** PP

            GRAS 286 ErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                     Er ll+++i+n v  + ++      ++  Wr+ + +aGF+p+++s+ a+ qa+++++++++ g++ve+++ slvl+Wk+++L+s+ aWr
  XP_009803486.1 541 ERSLLQPSIENTVLGRLRS----PDRMPPWRNLFASAGFSPIEFSNMAEIQAECVVKRTQVGGFHVEKRQMSLVLCWKQQELLSILAWR 625
                     **************99888....9999*************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098540.254237605IPR005202Transcription factor GRAS
PfamPF035143.2E-81265625IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 626 aa     Download sequence    Send to blast
MLVTTSHSPS ASASSSSCSY GGNMGEKSDL GFGDLDNLLP ELAGSDQTLF RCISGDMEDP  60
SISLKQLLQG GNENADLSCG VSVQSSGFEV SAAGSLAHTD NVSFSNSNLL LNANIEKIGS  120
VINSDNKQNV NFEHLNVNLL ARNLPPALSF QEQQSEQNSA YVNMLGSLSY DVTQEQPPPK  180
RHNSGTLGSS LSALLPEVPF FDSSGELLLR KQPLGQTRQQ VNFLPFHQFQ QKPLIVPKLE  240
AAVGGANGNL MVPCHQQQEQ QFIYDQIFQA SELLLAGQFS NAQMILARLN QQLSPLGKPF  300
KRSAFYFKEA LLLPFLLPCT STSFPPRIPT PFDCVLKMDA YKAFSEISPL IQFMNFTSNQ  360
PILEALGDAK EIHIIDFDIG CGAQWSSFMQ ELRSSNRKAT SLKITAFVSP STHHSVEIGI  420
MHESLTLFAN DVGIRFELEV INLDSFDPKT YPLSSLRSSE CEAIAINFPI WSISSCLFAF  480
PSLLHCMKQL SPKVVVSLER GCERTELPLK HHLLHALQYY EILLASIDAA NLTPEIGKKI  540
ERSLLQPSIE NTVLGRLRSP DRMPPWRNLF ASAGFSPIEF SNMAEIQAEC VVKRTQVGGF  600
HVEKRQMSLV LCWKQQELLS ILAWRC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A9e-2628662526375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF4819520.0AF481952.1 Petunia x hybrida hairy meristem (HAM) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009803484.10.0PREDICTED: scarecrow-like protein 6 isoform X1
RefseqXP_009803485.10.0PREDICTED: scarecrow-like protein 6 isoform X2
RefseqXP_009803486.10.0PREDICTED: scarecrow-like protein 6 isoform X1
TrEMBLQ8LL100.0Q8LL10_PETHY; Hairy meristem
STRINGPGSC0003DMT4000121040.0(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00150.13e-97GRAS family protein